The RAN domain within your query sequence starts at position 16 and ends at position 216, and its E-value is 1.25e-161.

VGDGGTGKTTFMKRHLTGEFEKEYVATLGVEVHTLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPSWHKDLVRVCENIPIVLCGNKVDVKDMKVKAKPILFHRKKNLQYYDISARSNYNFEKPFFWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDEEDDL
RAN

RAN

Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases
SMART ACC:SM000176
Description:Ran is involved in the active transport of proteins through nuclear pores.
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 762 RAN domains in 1 750 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing RAN domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing RAN domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:GTP-hydrolysis

Relevant references for this domain

Primary literature for the RAN domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the RAN domain.

ProteinDescriptionDisease / phenotype
A0A024RAV5_HUMANOMIM:190070 : Colorectal adenoma ; Colorectal cancer
RB27A_HUMANOMIM:603868 : Griscelli syndrome
OMIM:214450 : no description
RASK_HUMANOMIM:190070 : Colorectal adenoma ; Colorectal cancer
RASH_HUMANOMIM:190020 : Bladder cancer
OMIM:109800 : no description
RASN_HUMANOMIM:164790 : Colorectal cancer
RRAS2_HUMANOMIM:600098 : ONCOGENE TC21

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a RAN domain which could be assigned to a KEGG orthologous group, and not all proteins containing RAN domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain