The H3 domain within your query sequence starts at position 28 and ends at position 129, and its E-value is 1.5e-22.

VGSQTLRRRQKFMWLKEIKTLQKSTDLLFRKKPFSMVVREICEKFSRGVDFWWQAQALLALQEPRQCSLLPRQQKLSSSTSLRTPTSSPYMLVGSRFSPKTF
H3

H3

Histone H3
SMART ACC:SM000428
Description: -
InterPro ACC:IPR000164
InterPro abstract:

This entry includes histone H3 and its variant, CENP-A (Cse4 in budding yeast, Cnp1 in fission yeast, and CID/CenH3 in fruit flies). Two primate-specific forms of H3, known as H3.X and H3.Y, are found in the brain [ PUBMED:20819935 ].

Histone H3 is one of the five histones, along with H1/H5, H2A, H2B and H4. … expand

GO component:nucleosome (GO:0000786)
GO function:structural constituent of chromatin (GO:0030527), DNA binding (GO:0003677)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 9 119 H3 domains in 8 899 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing H3 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing H3 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the H3 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a H3 domain which could be assigned to a KEGG orthologous group, and not all proteins containing H3 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITEHISTONE_H3_2
InterProIPR000164
Pfamhistone