The DWNN domain within your query sequence starts at position 4 and ends at position 76, and its E-value is 3.92e-42.

VHYKFSSKLNYDTVTFDGLHISLCDLKKQIMGREKLKAADSDLQITNAQTKEEYTDDNALIPKNSSVIVRRIP
DWNN

DWNN

SMART ACC:SM001180
Description:DWNN is a ubiquitin like domain found at the N-terminus of the RBBP6 family of splicing-associated proteins (PUBMED:16396680). The DWNN domain is independently expressed in higher vertebrates so it may function as a novel ubiquitin-like modifier of other proteins (PUBMED:16396680).
InterPro ACC:IPR014891
InterPro abstract:

The ~75-residue DWNN (Domain With No Name) domain is highly conserved through eukaryotic species but is absent in prokaryotes. The DWNN domain is found only at the N terminus of the RBBP6 family of proteins which includes:

  • Mammalian RBBP6, a splicing-associated protein that plays a role in the induction of apoptosis and regulation of the cell cycle.
  • Drosophila melanogaster … expand
GO function:zinc ion binding (GO:0008270)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 209 DWNN domains in 2 209 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DWNN domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DWNN domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the DWNN domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DWNN domain which could be assigned to a KEGG orthologous group, and not all proteins containing DWNN domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamDWNN
InterProIPR014891