The RhoGEF domain within your query sequence starts at position 1044 and ends at position 1233, and its E-value is 1.42e-63.

VICELLETERTYVKDLNCLMERYLKPLQKETFLTQDELDVLFGNLTEMVEFQVEFLKTLEDGVRLVPDLEKLEKVDQFKKVLFSLGGSFLYYADRFKLYSAFCASHTKVPKVLVKAKTDTAFKAFLDAQNPRQQHSSTLESYLIKPIQRVLKYPLLLRELFALTDAESEEHYHLDVAIKTMNKVASHINE
RhoGEF

RhoGEF

Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases
SMART ACC:SM000325
Description:Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases Also called Dbl-homologous (DH) domain. It appears that PH domains invariably occur C-terminal to RhoGEF/DH domains. Improved coverage.
InterPro ACC:IPR000219
InterPro abstract:

The Rho family GTPases Rho, Rac and CDC42 regulate a diverse array of cellular processes. Like all members of the Ras superfamily, the Rho proteins cycle between active GTP-bound and inactive GDP-bound conformational states. Activation of Rho proteins through release of bound GDP and subsequent binding of GTP, is catalysed by guanine nucleotide exchange factors (GEFs) in the Dbl family. The proteins … expand

GO function:guanyl-nucleotide exchange factor activity (GO:0005085)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 39 736 RhoGEF domains in 38 458 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing RhoGEF domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing RhoGEF domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling
Binding / catalysis:Protein-binding, Rho-binding, guanine nucleotide exchange for Rho

Relevant references for this domain

Primary literature for the RhoGEF domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a RhoGEF domain which could be assigned to a KEGG orthologous group, and not all proteins containing RhoGEF domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamRhoGEF
InterProIPR000219