The ZnF_C4 domain within your query sequence starts at position 13 and ends at position 84, and its E-value is 7.2e-37.

VIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQCNVAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRD

ZnF_C4 c4 zinc finger in nuclear hormone receptors
SMART ACC:	SM000399
Description:	-
InterPro ACC:	IPR001628
InterPro abstract:	This entry represents the two C4-type zinc finger modules involved in DNA-binding. Steroid or nuclear hormone receptors constitute an important superfamily of transcription regulators that are involved in widely diverse physiological functions, including control of embryonic development, cell differentiation and homeostasis. The receptors function as dimeric molecules in nuclei to regulate … expand This entry represents the two C4-type zinc finger modules involved in DNA-binding. Steroid or nuclear hormone receptors constitute an important superfamily of transcription regulators that are involved in widely diverse physiological functions, including control of embryonic development, cell differentiation and homeostasis. The receptors function as dimeric molecules in nuclei to regulate the transcription of target genes in a ligand-responsive manner. Nuclear hormone receptors consist of a highly conserved DNA-binding domain that recognises specific sequences, connected via a linker region to a C-terminal ligand-binding domain ( IPR000536 ). In addition, certain nuclear hormone receptors have an N-terminal modulatory domain ( IPR001292 ). The DNA-binding domain can elicit either an activating or repressing effect by binding to specific regions of the DNA known as hormone-response elements [ PUBMED:15242341 PUBMED:15242339 ]. These response elements position the receptors, and the complexes recruited by them, close to the genes of which transcription is affected. The DNA-binding domains of nuclear receptors consist of two zinc-nucleated modules and a C-terminal extension, where residues in the first zinc module determine the specificity of the DNA recognition and residues in the second zinc module are involved in dimerisation. The DNA-binding domain is furthermore involved in several other functions including nuclear localisation, and interaction with transcription factors and co-activators [ PUBMED:15242339 ]. Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [ PUBMED:10529348 PUBMED:15963892 PUBMED:15718139 PUBMED:17210253 PUBMED:12665246 ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few [ PUBMED:11179890 ]. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target. collapse
GO process:	regulation of DNA-templated transcription (GO:0006355)
GO function:	DNA-binding transcription factor activity (GO:0003700), zinc ion binding (GO:0008270), sequence-specific DNA binding (GO:0043565)
Family alignment:	View the Family alignment or the Alignment consensus sequence
There are 29 577 ZnF_C4 domains in 29 290 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing ZnF_C4 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing ZnF_C4 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the ZnF_C4 domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the ZnF_C4 domain.

Protein	Description	Disease / phenotype
STF1_HUMAN		OMIM:184757 : Sex reversal, XY, with adrenal failure ; Adrenocortical insufficiency without ovarian defect
NR2E3_HUMAN		OMIM:604485 : Enhanced S-cone syndrome
		OMIM:268100 : Retinitis pigmentosa, late onset
		OMIM:268000 : no description
VDR_HUMAN		OMIM:601769 : Rickets, vitamin D-resistant
VDR_HUMAN		OMIM:277440 : ?Osteoporosis, involutional
ANDR_HUMAN		OMIM:313700 : Androgen insensitivity, several forms ; Spinal and bulbar muscular atrophy of Kennedy
ANDR_HUMAN		OMIM:313200 : Prostate cancer ; Perineal hypospadias ; Breast cancer, male, with Reifenstein syndrome

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a ZnF_C4 domain which could be assigned to a KEGG orthologous group, and not all proteins containing ZnF_C4 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITE	NUCLEAR_RECEPTOR
InterPro	IPR001628
Pfam	zf-C4