The NADH_4Fe-4S domain within your query sequence starts at position 285 and ends at position 330, and its E-value is 1.05e-22.

VKAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVKGDARPAEI
NADH_4Fe-4S

NADH_4Fe-4S

NADH-ubiquinone oxidoreductase-F iron-sulfur binding region
SMART ACC:SM000928
Description: -
InterPro ACC:IPR019575
InterPro abstract:

This entry represents the iron-sulphur binding domain of NADH-ubiquinone oxidoreductase 51kDa subunit from NADH:ubiquinone oxidoreductase.

Among the many polypeptide subunits that make up complex I, there is one with a molecular weight of 51kDa (in mammals), which is the second largest subunit of complex I [ PUBMED:2029890 expand

GO function:4 iron, 4 sulfur cluster binding (GO:0051539)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 22 767 NADH_4Fe-4S domains in 22 761 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing NADH_4Fe-4S domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing NADH_4Fe-4S domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Metabolic

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a NADH_4Fe-4S domain which could be assigned to a KEGG orthologous group, and not all proteins containing NADH_4Fe-4S domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR019575
PfamNADH_4Fe-4S