The TR_FER domain within your query sequence starts at position 25 and ends at position 338, and its E-value is 4.98e-175.

VKWCAVSEHENTKCISFRDHMKTVLPPDGPRLACVKKTSYPDCIKAISASEADAMTLDGGWVYDAGLTPNNLKPVAAEFYGSVEHPQTYYYAVAVVKKGTDFQLNQLEGKKSCHTGLGRSAGWVIPIGLLFCKLSEPRSPLEKDPVAFPKLCQLCPGCGCSSTQPFFGYVGAFKCLKDGGGDVAFVKHTTIFEVLPEKADRDQYELLCLDNTRKPVDQYEDCYLARIPSHAVVARKNNGKEDLIWEILKVAQEHFGKGKSKDFQLFSSPLGKDLLFKDSAFGLLRVPPRMDYRLYLGHNYVTAIRNQQEGVCPE
TR_FER

TR_FER

Transferrin
SMART ACC:SM000094
Description: -
InterPro ACC:IPR001156
InterPro abstract:

Transferrins are eukaryotic iron-binding glycoproteins that control the level of free iron in biological fluids [ PUBMED:3032619 ]. Evidence suggests that members of the TF family arose from the duplication and fusion of two homologous domains, with each duplicated domain binding one iron atom. Members of the family include … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 4 096 TR_FER domains in 2 538 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing TR_FER domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing TR_FER domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the TR_FER domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the TR_FER domain.

ProteinDescriptionDisease / phenotype
TRFE_HUMANOMIM:190000 : Atransferrinemia
OMIM:209300 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a TR_FER domain which could be assigned to a KEGG orthologous group, and not all proteins containing TR_FER domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001156
PROSITEPS00207