The SRP54_N domain within your query sequence starts at position 2 and ends at position 87, and its E-value is 7.47e-19.

VLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNKRKMIQHAVFKELVKLV
SRP54_N

SRP54_N

SRP54-type protein, helical bundle domain
SMART ACC:SM000963
Description:This entry represents the N-terminal helical bundle domain of the 54 kDa SRP54 component, a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 of the signal recognition particle has a three-domain structure: an N-terminal helical bundle domain, a GTPase domain, and the M-domain that binds the 7s RNA and also binds the signal sequence. The extreme C-terminal region is glycine-rich and lower in complexity and poorly conserved between species.
InterPro ACC:IPR013822
InterPro abstract:

This entry represents the N-terminal helical bundle domain of the 54kDa SRP54 component, a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 of the signal recognition particle has a three-domain structure: an N-terminal helical bundle domain, a GTPase domain, and the M-domain that binds the 7s RNA and also binds the signal sequence. The extreme … expand

GO process:SRP-dependent cotranslational protein targeting to membrane (GO:0006614)
GO function:GTP binding (GO:0005525)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 40 739 SRP54_N domains in 40 723 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing SRP54_N domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing SRP54_N domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the SRP54_N domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a SRP54_N domain which could be assigned to a KEGG orthologous group, and not all proteins containing SRP54_N domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR013822
PfamSRP54_N