The SR domain within your query sequence starts at position 34 and ends at position 133, and its E-value is 7.43e-19.

VMLSGSNSKCQGQVEIQMENKWKTVCSSSWRLSQDHSKNAQQASAVCKQLRCGDPLALGPFPSLNRPQNQVFCQGSPWSISNCNNTSSQDQCLPLSLICL
SR

SR

Scavenger receptor Cys-rich
SMART ACC:SM000202
Description:The sea ucrhin egg peptide speract contains 4 repeats of SR domains that contain 6 conserved cysteines. May bind bacterial antigens in the protein MARCO.
InterPro ACC:IPR001190
InterPro abstract:

The scavenger receptor cysteine-rich (SRCR) domain is an ancient and highly conserved domain of about 110 residues which is found in diverse secreted and cell-surface proteins, like the type I scavenger receptor, the speract receptor, CD5/Ly-1, CD6, or complement factor I [ PUBMED:1978939 ]. Tandem repeats of SRCR domains … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 45 697 SR domains in 14 875 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing SR domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing SR domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the SR domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a SR domain which could be assigned to a KEGG orthologous group, and not all proteins containing SR domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001190
PROSITESR_DOMAIN