The DALR_1 domain within your query sequence starts at position 399 and ends at position 538, and its E-value is 2.09e-22.

VMYNCARLATLFEGYKHGTEQGLYPTFPLVSSLDFSLLHDEGEWLLLFNSVLPFLDLLSQTVSLAGTPGLHIPVRTEMVCKFLVQLSMDFSSYYNRVHILGEPRPHLFGQMFARLQLLRAVREVFHTGLAMLGLPPLSHI
DALR_1

DALR_1

DALR anticodon binding domain
SMART ACC:SM000836
Description:This all alpha helical domain is the anticodon binding domain of Arginyl tRNA synthetase. This domain is known as the DALR domain after characteristic conserved amino acids (PUBMED:10447505).
InterPro ACC:IPR008909
InterPro abstract:

Aminoacyl-tRNA synthetase (aaRS) is a key enzyme during protein biosynthesis. Each aaRS contains a catalytic central domain (CCD), responsible for activating amino acid, and an anticodon-binding domain (ABD), necessary for binding the anticodon in cognate tRNA. aaRSs are classified into class I and II (aaRS-I and aaRS-II) based on the topologies of CCDs. Whereas the structure of the CCDs is similar … expand

GO process:arginyl-tRNA aminoacylation (GO:0006420)
GO function:arginine-tRNA ligase activity (GO:0004814), ATP binding (GO:0005524)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 33 789 DALR_1 domains in 33 786 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DALR_1 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DALR_1 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Translation

Relevant references for this domain

Primary literature for the DALR_1 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DALR_1 domain which could be assigned to a KEGG orthologous group, and not all proteins containing DALR_1 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR008909
PfamDALR_1