The AMP_N domain within your query sequence starts at position 18 and ends at position 155, and its E-value is 2.71e-39.

VPLALFALNRQRLCERLRKNGAVQAASAVVLQGGEEMQRYCTDTSIIFRQESFFHWAFGVVESGCYGVIDVDTGKSTLFVPRLPDSYATWMGKIHSKEYFKEKYAVDDVQYTDEIASVLTSRNPSVLLTLRGVNTDSG
AMP_N

AMP_N

Aminopeptidase P, N-terminal domain
SMART ACC:SM001011
Description:This domain is structurally very similar to the creatinase N-terminal domain. However, little or no sequence similarity exists between the two families.
InterPro ACC:IPR007865
InterPro abstract:

This entry represents the N-terminal domain of aminopeptidase P (X-Pro aminopeptidase I,II and III EC:3.4.11.9 ) and related sequences belonging to the peptidase M24B family. The domain is structurally very similar [ PUBMED:9520390 ] to the creatinase … expand

GO function:metalloaminopeptidase activity (GO:0070006), manganese ion binding (GO:0030145)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 15 332 AMP_N domains in 15 331 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing AMP_N domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing AMP_N domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Metabolic

Relevant references for this domain

Primary literature for the AMP_N domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a AMP_N domain which could be assigned to a KEGG orthologous group, and not all proteins containing AMP_N domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamAMP_N
InterProIPR007865