The TY domain within your query sequence starts at position 873 and ends at position 921, and its E-value is 1.17e-19.

VPQCDEYGHYVPTQCHHSTGYCWCVDRDGRELEGSRTPPGMRPPCLSTV
TY

TY

Thyroglobulin type I repeats.
SMART ACC:SM000211
Description:The N-terminal region of human thyroglobulin contains 11 type-1 repeats TY repeats are proposed to be inhibitors of cysteine proteases and binding partners of heparin.
InterPro ACC:IPR000716
InterPro abstract:

Thyroglobulin (Tg) is a large glycoprotein specific to the thyroid gland and is the precursor of the iodinated thyroid hormones thyroxine (T4) and triiodothyronine (T3). The N-terminal section of Tg contains 10 repeats of a domain of about 65 amino acids which is known as the Tg type-1 repeat [ PUBMED:3595599 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 14 817 TY domains in 7 575 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing TY domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing TY domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the TY domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the TY domain.

ProteinDescriptionDisease / phenotype
THYG_HUMANOMIM:138800 : Goiter, multinodular, 1
OMIM:188450 : Hypothyroidism, hereditary congenital ; Goiter, adolescent multinodular ; Goiter, nonendemic, simple

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a TY domain which could be assigned to a KEGG orthologous group, and not all proteins containing TY domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

Pfamthyroglobulin_1
InterProIPR000716
PROSITETY_DOMAIN