The eIF6 domain within your query sequence starts at position 3 and ends at position 204, and its E-value is 2.72e-136.

VRASFENNCEVGCFAKLTNAYCLVAIGGSENFYSVFEGELSDAIPVVHASIAGCRIIGRMCVGNRHGLLVPNNTTDQELQHIRNSLPDSVQIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCA
eIF6

eIF6

translation initiation factor 6
SMART ACC:SM000654
Description: -
InterPro ACC:IPR002769
InterPro abstract:

This family includes eukaryotic translation initiation factor 6 (eIF6) as well as presumed archaeal homologues.

The assembly of 80S ribosomes requires joining of the 40S and 60S subunits, which is triggered by the formation of an initiation complex on the 40S subunit. This event is rate-limiting for translation, and depends on external stimuli and the status of the cell. Eukaryotic translation … expand

GO process:cytosolic ribosome assembly (GO:0042256)
GO function:ribosome binding (GO:0043022)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 544 eIF6 domains in 2 542 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing eIF6 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing eIF6 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Translation
Binding / catalysis:RNA

Relevant references for this domain

Primary literature for the eIF6 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a eIF6 domain which could be assigned to a KEGG orthologous group, and not all proteins containing eIF6 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfameIF6
InterProIPR002769