The B3_4 domain within your query sequence starts at position 18 and ends at position 180, and its E-value is 2.5e-33.

VRPFAVAAVLRNIKFTKDRYDSFIELQEKLHQNICRKRALVAIGTHDLDTLSGPFTYTAKRPSDIKFKPLNKTKEYTACELMNIYKTDNHLKHYLHIIESKPLYPVIYDSNGVVLSMPPIINGNHSKITVNTRNIFIECTGTDFTKAKIVLDIIVTMFSEHCE
B3_4

B3_4

B3/4 domain
SMART ACC:SM000873
Description:This domain is found in tRNA synthetase beta subunits as well as in some non tRNA synthetase proteins.
InterPro ACC:IPR005146
InterPro abstract:

This entry represents the B3/B4 domain found in tRNA synthetase beta subunits as well as in some non-tRNA synthetase proteins. This domain has a 3-layer structure, and contains a β-sandwich fold of unusual topology, and contains a putative tRNA-binding structural motif [ PUBMED:7664121 ]. In Thermus thermophilus, both … expand

GO function:RNA binding (GO:0003723), phenylalanine-tRNA ligase activity (GO:0004826)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 29 643 B3_4 domains in 29 641 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing B3_4 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing B3_4 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Translation

Relevant references for this domain

Primary literature for the B3_4 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a B3_4 domain which could be assigned to a KEGG orthologous group, and not all proteins containing B3_4 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR005146
PfamB3_4