The KIND domain within your query sequence starts at position 3 and ends at position 190, and its E-value is 2.3e-80.

VSLAEALEVRGGPLQEEEIWAVLNQSAESLQEVFRRVSIADPAALGFIISPWSLLLLPSGSVSFTDENVSNQDLRAFTAPEVLQSHSLTSLADVEKIHIYSLGMTLYWGADHEVPQSQPIKLGDHLNSILLGMCEDVIYARVSVRTVLDACSAHIRNSNCAPSFSYVKQLVKLVLGNISGTDPLSRSS
KIND

KIND

kinase non-catalytic C-lobe domain
SMART ACC:SM000750
Description:It is an interaction domain identified as being similar to the C-terminal protein kinase catalytic fold (C lobe). Its presence at the N terminus of signalling proteins and the absence of the active-site residues in the catalytic and activation loops suggest that it folds independently and is likely to be non-catalytic. The occurrence of KIND only in metazoa implies that it has evolved from the catalytic protein kinase domain into an interaction domain possibly by keeping the substrate-binding features
InterPro ACC:IPR011019
InterPro abstract:

The KIND (kinase non-catalytic C-lobe domain) is a putative protein interaction domain, which has been identified as being similar to the C-terminal protein kinase catalytic fold (C lobe).

The presence of the KIND domain at the N terminus of signalling proteins and the absence of the active site residues in the catalytic and activation loops suggest that it folds independently and is … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 650 KIND domains in 2 324 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing KIND domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing KIND domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the KIND domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a KIND domain which could be assigned to a KEGG orthologous group, and not all proteins containing KIND domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR011019