The Lipid_DES domain within your query sequence starts at position 5 and ends at position 43, and its E-value is 4.36e-20.

VSREEFEWVYTDQPHAARRKEILAKYPEIKSLMKPDHNL
Lipid_DES

Lipid_DES

Sphingolipid Delta4-desaturase (DES)
SMART ACC:SM001269
Description:Sphingolipids are important membrane signalling molecules involved in many different cellular functions in eukaryotes. Sphingolipid delta 4-desaturase catalyses the formation of (E)-sphing-4-enine (PUBMED:11937514). Some proteins in this family have bifunctional delta 4-desaturase/C-4-hydroxylase activity. Delta 4-desaturated sphingolipids may play a role in early signalling required for entry into meiotic and spermatid differentiation pathways during Drosophila spermatogenesis (PUBMED:119375141). This small domain associates with FA_desaturase (PFAM PF00487) and appears to be specific to sphingolipid delta 4-desaturase.
InterPro ACC:IPR013866
InterPro abstract:

This small domain appears to be specific to sphingolipid delta 4-desaturase. Sphingolipids are important membrane signalling molecules involved in many different cellular functions in eukaryotes. Sphingolipid delta 4-desaturase catalyses the formation of (E)-sphing-4-enine [ PUBMED:11937514 ]. Some proteins with this … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 787 Lipid_DES domains in 1 784 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Lipid_DES domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Lipid_DES domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling

Relevant references for this domain

Primary literature for the Lipid_DES domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Lipid_DES domain which could be assigned to a KEGG orthologous group, and not all proteins containing Lipid_DES domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

Links to other resources describing this domain

PfamLipid_DES
InterProIPR013866