The KRAB domain within your query sequence starts at position 28 and ends at position 89, and its E-value is 1.01e-19.

VTYDDVHVNFTWEEWALLDPSQKDLYRDVMLETYRNLAAIGMKEVILKRNFLNLLNMIKTLH
KRAB

KRAB

krueppel associated box
SMART ACC:SM000349
Description: -
InterPro ACC:IPR001909
InterPro abstract:

The Krueppel-associated box (KRAB) is a domain of around 75 amino acids that is found in the N-terminal part of about one third of eukaryotic Krueppel-type C2H2 zinc finger proteins (ZFPs) [ PUBMED:14519192 ]. It is enriched in charged amino acids and can be divided into subregions A and B, which are predicted to fold … expand

GO process:regulation of DNA-templated transcription (GO:0006355)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 50 777 KRAB domains in 49 028 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing KRAB domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing KRAB domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the KRAB domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a KRAB domain which could be assigned to a KEGG orthologous group, and not all proteins containing KRAB domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001909