The DUF3385 domain within your query sequence starts at position 854 and ends at position 1024, and its E-value is 1.51e-93.

VVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHKVNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFRDQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLVSFVK
DUF3385

DUF3385

Domain of unknown function
SMART ACC:SM001346
Description:This domain is found in eukaryotes.
InterPro ACC:IPR024585
InterPro abstract:

This entry represents a domain found in serine/threonine-protein kinase mTOR (target of rapamycin), a central regulator of cellular metabolism, growth and survival in response to hormones, growth factors, nutrients, energy and stress signals [ PUBMED:31112131 PUBMED:31601708 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 788 DUF3385 domains in 1 786 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DUF3385 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DUF3385 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DUF3385 domain which could be assigned to a KEGG orthologous group, and not all proteins containing DUF3385 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamDUF3385
InterProIPR024585