The LNS2 domain within your query sequence starts at position 637 and ends at position 793, and its E-value is 1.4e-105.

VVISDIDGTITKSDALGHILPQLGKDWTHQGITSLYHKIHLNGYKFLYCSARAIGMADLTKGYLQWVSEHGCGLPKGPILLSPSSLFSALHREVIEKKPEVFKVACLSDIQQLFLPQRQPFHAAFGNRPNDVFAYRQVGLPESRIFTVNPRGELIQE
LNS2

LNS2

SMART ACC:SM000775
Description:This domain is found in Saccharomyces cerevisiae protein SMP2, proteins with an N-terminal lipin domain and phosphatidylinositol transfer proteins. SMP2 is involved in plasmid maintenance and respiration. Lipin proteins are involved in adipose tissue development and insulin resistance.
InterPro ACC:IPR031315
InterPro abstract:

This domain is found in lipins, lipin homologues from Saccharomyces cerevisiae (Smp2, PAH1) [ PUBMED:16467296 ] and Schizosaccharomyces pombe (Ned1) [ PUBMED:12376568 ], and in class II phosphatidylinositol transfer proteins (PITP) [ expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 5 196 LNS2 domains in 5 194 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing LNS2 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing LNS2 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the LNS2 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a LNS2 domain which could be assigned to a KEGG orthologous group, and not all proteins containing LNS2 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR031315
PfamLNS2 (Lipin/Ned1/Smp2)