The ADF domain within your query sequence starts at position 2 and ends at position 98, and its E-value is 1.56e-12.

VVLEDELQNISPEELKLELPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRTTDDLTETWLKEKLA
ADF

ADF

Actin depolymerisation factor/cofilin -like domains
SMART ACC:SM000102
Description:Severs actin filaments and binds to actin monomers.
InterPro ACC:IPR002108
InterPro abstract:

The actin-depolymerising factor homology (ADF-H) domain is an ~150-amino acid motif that is present in three phylogenetically distinct classes of eukaryotic actin-binding proteins [ PUBMED:9693358 PUBMED:12207032 PUBMED:9047337 expand

GO function:actin binding (GO:0003779)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 9 609 ADF domains in 8 060 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing ADF domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing ADF domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:Actin-binding, actin-depolymerization

Relevant references for this domain

Primary literature for the ADF domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a ADF domain which could be assigned to a KEGG orthologous group, and not all proteins containing ADF domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

Pfamcofilin_ADF
InterProIPR002108