The PlsC domain within your query sequence starts at position 145 and ends at position 274, and its E-value is 8.3e-21.

All catalytic sites are present in this domain, and marked green in the sequence below. Check the literature (PubMed 11377195 ) for details.

VVLLPSHRSYIDFLMLSFILYSYDLPVPVIAAGMDFLGMRVVSELLRMSGAFFMRRTFGGNKLYWAVFSEYVKTMLRCGYAPVEFFLEGTRSRAAKTLTPKFGLLNIVMEPFFKREVFDTYFVPISISYD
PlsC

PlsC

Phosphate acyltransferases
SMART ACC:SM000563
Description:Function in phospholipid biosynthesis and have either glycerolphosphate, 1-acylglycerolphosphate, or 2-acylglycerolphosphoethanolamine acyltransferase activities. Tafazzin, the product of the gene mutated in patients with Barth syndrome, is a member of this family.
InterPro ACC:IPR002123
InterPro abstract:

This family is found in diverse acyltransferases involved in phospholipid biosynthesis [ PUBMED:9259571 ]. This domain is found in tafazzins, phospholipid transacylases involved in the remodeling of cardiolipin, a mitochondrial phospholipid required for oxidative phosphorylation and whose defects cause of Barth syndrome; … expand

GO function:acyltransferase activity (GO:0016746)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 106 677 PlsC domains in 106 607 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PlsC domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PlsC domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the PlsC domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the PlsC domain.

ProteinDescriptionDisease / phenotype
GNPAT_HUMANOMIM:602744 : Chondrodysplasia punctata, rhizomelic, type 2
OMIM:222765 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PlsC domain which could be assigned to a KEGG orthologous group, and not all proteins containing PlsC domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR002123