The Arfaptin domain within your query sequence starts at position 21 and ends at position 248, and its E-value is 1.54e-125.

VVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFSSQQRLALRNPLCRFHQEVETFRHRAISDTWLTVNRMEQYRTEYRGALLWMKDVSQELDPDLYKQMEKFRKVQTQVRLAKKNFDKLKMDVCQKVDLLGASRCNLLSHMLATYQTTLLHFWEKTSHTM
Arfaptin

Arfaptin

Arfaptin-like domain
SMART ACC:SM001015
Description:Arfaptin interacts with ARF1, a small GTPase involved in vesicle budding at the Golgi complex and immature secretory granules. The structure of arfaptin shows that upon binding to a small GTPase, arfaptin forms an elongated, crescent-shaped dimer of three-helix coiled-coils. The N-terminal region of ICA69 is similar to arfaptin.
InterPro ACC:IPR010504
InterPro abstract:

The arfaptin homology (AH) domain is a protein domain found in a range of proteins, including arfaptins, protein kinase C-binding protein PICK1 [ PUBMED:10623590 ] and mammalian 69kDa islet cell autoantigen (ICA69) [ PUBMED:12682071 ]. The AH … expand

GO function:protein domain specific binding (GO:0019904)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 577 Arfaptin domains in 3 576 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Arfaptin domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Arfaptin domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:

Relevant references for this domain

Primary literature for the Arfaptin domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Arfaptin domain which could be assigned to a KEGG orthologous group, and not all proteins containing Arfaptin domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR010504
PfamArfaptin