The GLECT domain within your query sequence starts at position 31 and ends at position 165, and its E-value is 1.56e-15.

VYFRGHIKGGMRPGKKVLVMGIVDHNPKSFAISLTCGDSEDPPADVAIELKVVFTNQQVFRNSCISGESDEENLAFPYFPFVPDQPFRMEIFCQQPCFRVLVDGHHLFDFYHRIQTLSAIDSIKISGDLQITKLG
GLECT

GLECT

Galectin
SMART ACC:SM000276
Description:Galectin - galactose-binding lectin
InterPro ACC:IPR001079
InterPro abstract:

Galectins (also known as galaptins or S-lectin) are a family of proteins defined by having at least one characteristic carbohydrate recognition domain (CRD) with an affinity for beta-galactosides and sharing certain sequence elements. Members of the galectins family are found in mammals, birds, amphibians, fish, nematodes, sponges, and some fungi. Galectins are known to carry out intra- and extracellular … expand

GO function:carbohydrate binding (GO:0030246)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 9 997 GLECT domains in 7 376 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing GLECT domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing GLECT domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a GLECT domain which could be assigned to a KEGG orthologous group, and not all proteins containing GLECT domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITEGALAPTIN
InterProIPR001079
PfamGal-bind_lectin