The RL11 domain within your query sequence starts at position 13 and ends at position 144, and its E-value is 4e-62.

VYLRCIGEEVGATSALTPKIGPLGLSPKKVGEDIAKATGDWKGLRITVKLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHSGNITFDEIINIARQMRHRSLARELSGTIKEILGTAQSVGCNVD
RL11

RL11

Ribosomal protein L11/L12
SMART ACC:SM000649
Description: -
InterPro ACC:IPR000911
InterPro abstract:

Ribosomal protein uL11, together with proteins L10 and L7/L12, and 23S rRNA, form the L7/L12 stalk on the surface of the large subunit of the ribosome. The homologous eukaryotic cytoplasmic protein uL11 was called in the past 60S ribosomal protein L12, which is distinct from the L12 involved in the formation of the L7/L12 stalk. The C-terminal domain (CTD) of uL11 is essential for binding 23S … expand

GO process:translation (GO:0006412)
GO component:ribosome (GO:0005840)
GO function:structural constituent of ribosome (GO:0003735)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 18 448 RL11 domains in 18 446 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing RL11 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing RL11 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Translation
Binding / catalysis:RNA-binding

Relevant references for this domain

Primary literature for the RL11 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a RL11 domain which could be assigned to a KEGG orthologous group, and not all proteins containing RL11 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamRibosomal_L11
InterProIPR000911