The NPP domain within your query sequence starts at position 27 and ends at position 71, and its E-value is 1.55e-22.

WCLESSQCQDLTTESNLLACIRACKLDLSLETPVFPGNGDEQPLT
NPP

NPP

Pro-opiomelanocortin, N-terminal region
SMART ACC:SM001364
Description:This family features the N-terminal peptide of pro-opiomelanocortin (NPP). It is thought to represent an important pituitary peptide, given its high yield from pituitary glands, and exhibits a potent in vitro aldosterone-stimulating activity (PMID:6945581).
InterPro ACC:IPR013593
InterPro abstract:

This domain represents the N-terminal peptide of pro-opiomelanocortin (NPP). It is thought to represent an important pituitary peptide, given its high yield from pituitary glands, and exhibits a potent in vitro aldosterone-stimulating activity [ PUBMED:6945581 ].

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 276 NPP domains in 275 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing NPP domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing NPP domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the NPP domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a NPP domain which could be assigned to a KEGG orthologous group, and not all proteins containing NPP domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Links to other resources describing this domain

PfamNPP
InterProIPR013593