The PLAc domain within your query sequence starts at position and ends at position , and its E-value is < 1e-12.

Some of the required catalytic sites were not detected in this domain, and are marked red in the sequence below. The domain is probably inactive. Check the literature (PubMed 10319815 ) for details.

Catalytic residues
Position
DomainProteinAmino acidPresent?
N/AN/ASNo
WNGTLSTSANPELSGNSTYQSGAIASAISEATDGIPITALLGSSTSGNTTSNSTTSTSSNVTSNSNSSSNTTLNSNSS
PLAc

PLAc

Cytoplasmic phospholipase A2, catalytic subunit
SMART ACC:SM000022
Description:Cytosolic phospholipases A2 hydrolyse arachidonyl phospholipids. Family includes phospholipases B isoforms.
InterPro ACC:IPR002642
InterPro abstract:

This family consists of lysophospholipase / phospholipase B EC:3.1.1.5 and cytosolic phospholipase A2 which also has a C2 domain IPR000008. Phospholipase B enzymes catalyse the release of fatty acids from lysophsopholipids and are capable in … expand

GO process:phospholipid catabolic process (GO:0009395)
GO function:phospholipase activity (GO:0004620)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 4 116 PLAc domains in 4 116 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PLAc domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PLAc domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:Phosphatidylcholine 2-acylhydrolase, lysophospholipase

Relevant references for this domain

Primary literature for the PLAc domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PLAc domain which could be assigned to a KEGG orthologous group, and not all proteins containing PLAc domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR002642