The FBA domain within your query sequence starts at position 108 and ends at position 289, and its E-value is 1.07e-57.

WQLLFLERPLYRNLLSSPNPEGINIYQPAPPTGPTRKPLKELGNFRGWYITTQNLQGPLSWTVKEQCVNLLAKKLWEELLDDEQPDITIMDWFEDSRLDQCVYELHVWLLAADRRTVIAQHHVAPRTNGRGPPGRWIQVSHVFRQYGPGVRFVYFQHKAKNRMEPGGLRRTRVTDSSVSVQL
FBA

FBA

F-box associated region
SMART ACC:SM001198
Description:Members of this family are associated with F-box domains, hence the name FBA. This domain is probably involved in binding other proteins that will be targeted for ubiquitination. Q9UK22 is involved in binding to N-glycosylated proteins.
InterPro ACC:IPR007397
InterPro abstract:

F-box proteins have a bipartite structure: they contain a carboxy-terminaldomain that interacts with substrates and a 42-48 amino-acid F-box domain which binds to the protein Skp1. A subset of F-box proteins ischaracterised by a ~180-residue carboxy-terminal region, which has been calledthe F-box-associated (FBA) domain [ PUBMED:10531037 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 891 FBA domains in 1 854 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing FBA domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing FBA domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Interaction (with the environment)

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a FBA domain which could be assigned to a KEGG orthologous group, and not all proteins containing FBA domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamFBA
InterProIPR007397