The Telomerase_RBD domain within your query sequence starts at position 449 and ends at position 584, and its E-value is 5.02e-75.

WQVYGFLRACLCKVVSASLWGTRHNERRFFKNLKKFISLGKYGKLSLQELMWKMKVEDCHWLRSSPGKDRVPAAEHRLRERILATFLFWLMDTYVVQLLRSFFYITESTFQKNRLFFYRKSVWSKLQSIGVRQHLE
Telomerase_RBD

Telomerase_RBD

Telomerase ribonucleoprotein complex - RNA binding domain
SMART ACC:SM000975
Description:Telomeres in most organisms are comprised of tandem simple sequence repeats (PUBMED:9671704). The total length of telomeric repeat sequence at each chromosome end is determined in a balance of sequence loss and sequence addition (PUBMED:9671704). One major influence on telomere length is the enzyme telomerase (PUBMED:9671704). It is a reverse transcriptase that adds these simple sequence repeats to chromosome ends by copying a template sequence within the RNA component of the enzyme (PUBMED:9671704). The RNA binding domain of telomerase - TRBD - is made up of twelve alpha helices and two short beta sheets (PUBMED:17997966). How telomerase and associated regulatory factors physically interact and function with each other to maintain appropriate telomere length is poorly understood. It is known however that TRBD is involved in formation of the holoenzyme (which performs the telomere extension) in addition to recognition and binding of RNA (PUBMED:17997966).
InterPro ACC:IPR021891
InterPro abstract:

Telomeres in most organisms are comprised of tandem simple sequence repeats [ PUBMED:9671704 ]. The total length of telomeric repeat sequence at each chromosome end is determined in a balance of sequence loss and sequence addition [ PUBMED:9671704 expand

GO function:RNA-directed DNA polymerase activity (GO:0003964)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 299 Telomerase_RBD domains in 1 298 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Telomerase_RBD domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Telomerase_RBD domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transport

Relevant references for this domain

Primary literature for the Telomerase_RBD domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Telomerase_RBD domain which could be assigned to a KEGG orthologous group, and not all proteins containing Telomerase_RBD domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR021891
PfamTelomerase_RBD