The KRBA1 domain within your query sequence starts at position 586 and ends at position 629, and its E-value is 7.71e-12.

WQWPQEETATMPSPLHRLENSLRGILPVRPLRFTCVTGPGPSPS
KRBA1

KRBA1

KRBA1 family repeat
SMART ACC:SM001258
Description:KRBA1 is a short repeating motif found in mammalian proteins. It is characterised by a highly conserved sequence of residues, SSPLxxLxxCLK. The function of the repeat, which can be present in up to seven copies, is unknown as is the function of the full length proteins.
InterPro ACC:IPR029317
InterPro abstract:

KRBA1 is a short repeating motif found in mammalian proteins. It is characterised by a highly conserved sequence of residues, SSPLxxLxxCLK. The function of the repeat, which can be present in up to seven copies, is unknown as is the function of the full length proteins.

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 771 KRBA1 domains in 335 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing KRBA1 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing KRBA1 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a KRBA1 domain which could be assigned to a KEGG orthologous group, and not all proteins containing KRBA1 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

Links to other resources describing this domain

PfamKRBA1
InterProIPR029317