The DSL domain within your query sequence starts at position 156 and ends at position 218, and its E-value is 1.98e-23.

WRTDEQNDTLTRLSYSYRVICSDNYYGESCSRLCKKRDDHFGHYECQPDGSLSCLPGWTGKYC
DSL

DSL

delta serrate ligand
SMART ACC:SM000051
Description: -
InterPro ACC:IPR001774
InterPro abstract:

Ligands of the Delta/Serrate/lag-2 (DSL) family and their receptors, members of the lin-12/Notch family, mediate cell-cell interactions that specify cell fate in invertebrates and vertebrates. In Caenorhabditis elegans, two DSL genes, lag-2 and apx-1, influence different cell fate decisions during development [ PUBMED:8575327 expand

GO process:cell communication (GO:0007154)
GO component:membrane (GO:0016020)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 659 DSL domains in 2 480 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DSL domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DSL domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the DSL domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DSL domain which could be assigned to a KEGG orthologous group, and not all proteins containing DSL domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001774