The MBT domain within your query sequence starts at position 280 and ends at position 380, and its E-value is 5.34e-53.

WSWESYLEEQKAVTAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQLP
MBT

MBT

Present in Drosophila Scm, l(3)mbt, and vertebrate SCML2
SMART ACC:SM000561
Description:Present in Drosophila Scm, l(3)mbt, and vertebrate SCML2. These proteins are involved in transcriptional regulation.
InterPro ACC:IPR004092
InterPro abstract:

The function of the malignant brain tumor (MBT) repeat is unknown, but is found in a number of nuclear proteins involved in transcriptional repression. The repeat contains a completely conserved glutamate at its amino terminus that may be important for function.

The crystal structure of the two MBT repeats of human SCM-like 2 protein has been reported. Each repeat consists of an extended … expand

GO process:regulation of DNA-templated transcription (GO:0006355)
GO component:nucleus (GO:0005634)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 15 038 MBT domains in 5 088 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing MBT domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing MBT domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the MBT domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a MBT domain which could be assigned to a KEGG orthologous group, and not all proteins containing MBT domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR004092