The HNHc domain within your query sequence starts at position 985 and ends at position 1036, and its E-value is 5.64e-3.

WTAKLPLEQLNEMLRNPGEGHFWQVDHIRPVYEGGGQCSLDNLQTLCTVCHK
HNHc

HNHc

HNH nucleases
SMART ACC:SM000507
Description: -
InterPro ACC:IPR003615
InterPro abstract:

This domain is found in HNH family of nucleases that includes yeast intron 1 protein, human DNA annealing helicase and endonuclease ZRANB3, bacterial CRISPR-associated endonuclease Cas9, colicins, pyocins and endonuclease HphI. Members in this group are found in all domains of life.

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 90 127 HNHc domains in 89 843 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing HNHc domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing HNHc domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the HNHc domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a HNHc domain which could be assigned to a KEGG orthologous group, and not all proteins containing HNHc domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003615