The ZnF_UBR1 domain within your query sequence starts at position 1177 and ends at position 1244, and its E-value is 5.42e-27.

WTGAEHINQDIFECRTCGLLESLCCCTECARVCHKGHDCKLKRTSPTAYCDCWEKCKCKTLIAGQKSA
ZnF_UBR1

ZnF_UBR1

Putative zinc finger in N-recognin, a recognition component of the N-end rule pathway
SMART ACC:SM000396
Description:Domain is involved in recognition of N-end rule substrates in yeast Ubr1p
InterPro ACC:IPR003126
InterPro abstract:

It has been observed that the identity of N-terminal residues of a protein is related to the half life of the protein. This observation yields a rule, called the N-end rule [ PUBMED:8901547 ]. Similar but distinct versions of the N-end rule operate in all organisms examined, from mammals to fungi and bacteria. In eukaryotes … expand

GO function:zinc ion binding (GO:0008270)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 060 ZnF_UBR1 domains in 2 051 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing ZnF_UBR1 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing ZnF_UBR1 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the ZnF_UBR1 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a ZnF_UBR1 domain which could be assigned to a KEGG orthologous group, and not all proteins containing ZnF_UBR1 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003126