The MATH domain within your query sequence starts at position 24 and ends at position 130, and its E-value is 3.37e-11.

WTISNFSFFMEGTREKITSPKFSLEASDKVEWCLRVHPNGSDEESKDYLSVYLGLLHCQKSPVWAKYEFWIINSQGEKYQSMKRTNVVSFQKNQYRGFKKFILRDFL
MATH

MATH

meprin and TRAF homology
SMART ACC:SM000061
Description: -
InterPro ACC:IPR002083
InterPro abstract:

Although apparently functionally unrelated, intracellular TRAFs and extracellular meprins share a conserved region of about 180 residues, the meprin and TRAF homology (MATH) domain [ PUBMED:12387856 ]. Meprins are mammalian tissue-specific metalloendopeptidases of the astacin family implicated in developmental, normal … expand

GO function:protein binding (GO:0005515)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 16 432 MATH domains in 14 479 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing MATH domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing MATH domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a MATH domain which could be assigned to a KEGG orthologous group, and not all proteins containing MATH domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamMATH
InterProIPR002083