The VPS10 domain within your query sequence starts at position 1 and ends at position 320, and its E-value is 6.99e-58.

XFAAVQEWNQNDTYNLYISDTRGVYFTLALENVQSSRGPEGNVMIDLYEQG
VPS10

VPS10

SMART ACC:SM000602
Description: -
InterPro ACC:IPR006581
InterPro abstract:

Yeast Vps10p is a receptor for sorting and transport of the soluble vacuolar hydrolase carboxypeptidase Y to the lysosome-like vacuole [ PUBMED:11801606 ]. In mammalian cells, proteins containing this domain are involved in the transport of lipoproteins and sorting of endosomal proteins. They may also act as receptors … expand

GO component:membrane (GO:0016020)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 763 VPS10 domains in 3 066 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing VPS10 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing VPS10 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the VPS10 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a VPS10 domain which could be assigned to a KEGG orthologous group, and not all proteins containing VPS10 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006581