The DUF4208 domain within your query sequence starts at position 1 and ends at position 58, and its E-value is 1.59e-4.

XLEHTRNCLLKIGDRIAECLKAYSDQEHIKLWRRNLWIFVSKFTEFDARKLHKLYKMA
DUF4208

DUF4208

SMART ACC:SM001176
Description:This domain is found at the C-terminus of chromodomain-helicase-DNA-binding proteins. The exact function of the domain is undetermined.
InterPro ACC:IPR025260
InterPro abstract:

This entry represents a domain found at the C terminus of chromodomain-helicase-DNA-binding proteins, including Chromodomain-helicase-DNA-binding protein 1 from human (CHD1), an ATP-dependent chromatin-remodeling factor which acts as substrate recognition component of the transcription regulatory histone acetylation (HAT) complex SAGA. This protein functions to modulate the efficiency of pre-mRNA … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 238 DUF4208 domains in 2 236 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DUF4208 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DUF4208 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DUF4208 domain which could be assigned to a KEGG orthologous group, and not all proteins containing DUF4208 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamDUF4208
InterProIPR025260