The TBOX domain within your query sequence starts at position 1 and ends at position 156, and its E-value is 4.56e-80.

XRMFPVLKISVTGLDPNAMYSLLLDFVRTDSHRWKYVNGEWVPAGKPEVSSHSCVYIHPDSPNFGAHWMKAPISFSKVKLTNKLNGGGQIMLNSLHKYEPQVHIVRVGGAHRMVMNCSFPETQFIAVTAYQNEEITALKIKYNPFAKAFLDAKERN
TBOX

TBOX

Domain first found in the mice T locus (Brachyury) protein
SMART ACC:SM000425
Description: -
InterPro ACC:IPR046360
InterPro abstract:

This is the highly conserved DNA-binding domain of T-box transcription factors.

Transcription factors of the T-box family are required both for early cell-fate decisions, such as those necessary for formation of the basic vertebrate body plan, for differentiation and organogenesis [ PUBMED:12093383 ] and also … expand

GO process:regulation of DNA-templated transcription (GO:0006355)
GO function:RNA polymerase II cis-regulatory region sequence-specific DNA binding (GO:0000978), DNA-binding transcription factor activity (GO:0003700)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 8 800 TBOX domains in 8 777 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing TBOX domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing TBOX domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:DNA-binding

Relevant references for this domain

Primary literature for the TBOX domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the TBOX domain.

ProteinDescriptionDisease / phenotype
TBX5_HUMANOMIM:601620 : Holt-Oram syndrome
OMIM:142900 : no description
TBX3_HUMANOMIM:601621 : Ulnar-mammary syndrome
OMIM:181450 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a TBOX domain which could be assigned to a KEGG orthologous group, and not all proteins containing TBOX domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR046360
PROSITETBOX_1
PfamT-box