The WGR domain within your query sequence starts at position 64 and ends at position 141, and its E-value is 1.83e-37.
YDCTLNQTNIGNNNNKFYIIQLLEEGSRFFCWNRWGRVGEVGQSKMNHFTCLEDAKKDFKKKFWEKTKNKWEERDRFV
WGRProposed nucleic acid binding domain | |
|---|---|
| SMART ACC: | SM000773 |
| Description: | This domain is named after its most conserved central motif. It is found in a variety of polyA polymerases as well as in molybdate metabolism regulators (e.g. in E.coli) and other proteins of unknown function. The domain is found in isolation in some proteins and is between 70 and 80 residues in length. It is proposed that it may be a nucleic acid binding domain. |
| InterPro ACC: | IPR008893 |
| InterPro abstract: | |
| Family alignment: | View the Family alignment or the Alignment consensus sequence |
| There are 6 953 WGR domains in 6 872 proteins in SMART's NRDB database. | |
Taxonomic distribution of proteins containing WGR domains
The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing WGR domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.
KEGG pathways involving proteins which contain this domain
This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a WGR domain which could be assigned to a KEGG orthologous group, and not all proteins containing WGR domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.
KEGG pathways
Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.
KEGG orthologous groups
Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.
3D structures in PDB containing this domain
Links to other resources describing this domain
| InterPro | IPR008893 |
|---|---|
| Pfam | WGR domain |