The BOP1NT domain within your query sequence starts at position 130 and ends at position 388, and its E-value is 1.38e-177.

YDEFPHVGYDLDGKRIYKPLRTRDELDQFLDKMDDPDFWRTVQDKMTGRDLRLTDEQVALVHRLQRGQFGDSGFNPYEPAVDFFSGDIMIHPVTNRPADKRSFIPSLVEKEKVSRMVHAIKMGWIKPRRPHDPTPSFYDLWAQEDPNAVLGRHKMHVPAPKLALPGHAESYNPPPEYLPTEEERSAWMQQEPVERKLNFLPQKFPSLRTVPAYSRFIQERFERCLDLYLCPRQRKMRVNVDPEDLIPKLPRPRDLQPFP
BOP1NT

BOP1NT

BOP1NT (NUC169) domain
SMART ACC:SM001035
Description:This N terminal domain is found in BOP1-like WD40 proteins.
InterPro ACC:IPR012953
InterPro abstract:

This domain is found in the N-terminal region of BOP1-like WD40 proteins. Bop1 is a nucleolar protein involved in rRNA processing, thereby controlling the cell cycle [ PUBMED:16362343 ]. It is required for the maturation of the 25S and 5.8S ribosomal RNAs. It may serve as an essential factor in ribosome formation that … expand

GO process:rRNA processing (GO:0006364)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 684 BOP1NT domains in 1 683 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing BOP1NT domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing BOP1NT domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the BOP1NT domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a BOP1NT domain which could be assigned to a KEGG orthologous group, and not all proteins containing BOP1NT domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamBOP1NT
InterProIPR012953