The AWS domain within your query sequence starts at position 2081 and ends at position 2133, and its E-value is 3.95e-26.

YEATTCNCKKPDDDTRKGCGDDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEW
AWS

AWS

associated with SET domains
SMART ACC:SM000570
Description:subdomain of PRESET
InterPro ACC:IPR006560
InterPro abstract:

This domain, Associated With SET (AWS), whose specific function is still unknown, is found in a group of histone-lysine N-methyltransferases and similar eukaryotic proteins, including Histone-lysine N-methyltransferase, H3 lysine-36 specific from humans (H3-K36-HMTase or Nsd1). Nsd1 is a transcriptional intermediary factor capable of both negatively or positively influencing transcription, depending … expand

GO component:nucleus (GO:0005634)
GO function:histone methyltransferase activity (GO:0042054)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 935 AWS domains in 3 932 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing AWS domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing AWS domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the AWS domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a AWS domain which could be assigned to a KEGG orthologous group, and not all proteins containing AWS domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006560