The BTP domain within your query sequence starts at position 27 and ends at position 104, and its E-value is 1.76e-32.

YHLARRRTLQVVVSSLLTEAGFESAEKASVETLTEMLQSYISEIGRSAKSYCEHTARTQPTLSDIVVTLVEMGFNVDT
BTP

BTP

Bromodomain transcription factors and PHD domain containing proteins
SMART ACC:SM000576
Description:subdomain of archael histone-like transcription factors
InterPro ACC:IPR006565
InterPro abstract:

This domain is found in eukaryotic bromodomain containing transcription factors and PHD domain containing proteins ( IPR001965 ). This domain has a histone-like fold and is predicted to bind DNA [ PUBMED:11779830 ].

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 233 BTP domains in 2 233 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing BTP domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing BTP domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:DNA-binding

Relevant references for this domain

Primary literature for the BTP domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a BTP domain which could be assigned to a KEGG orthologous group, and not all proteins containing BTP domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006565