The DUF3585 domain within your query sequence starts at position 757 and ends at position 897, and its E-value is 3.1e-63.

YIPQEELQRQLQDIESQLDALELRGVELEKRLRAAEGDASEDSLMVDWFRLIHEKQLLLRLESELMYKSKDQRLEEQQLDLQGELRRLMDKPEGLKSPQDRQREQELLSQYVNTVNDRSDIVDFLDEDRLREQEEDQMLEN
DUF3585

DUF3585

SMART ACC:SM001203
Description:This domain is found in eukaryotes. This domain is typically between 135 and 149 amino acids in length and is found associated with the CH domain.
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 6 259 DUF3585 domains in 6 259 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DUF3585 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DUF3585 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DUF3585 domain which could be assigned to a KEGG orthologous group, and not all proteins containing DUF3585 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamDUF3585