The APC2 domain within your query sequence starts at position 772 and ends at position 832, and its E-value is 3.67e-27.

YIQAMLTNLESLSLERIYSMLRMFVMTGPALAEIDLQELQGYLQKKVRDQQLIYSAGVYRL
APC2

APC2

Anaphase promoting complex (APC) subunit 2
SMART ACC:SM001013
Description:The anaphase promoting complex or cyclosome (APC2) is an E3 ubiquitin ligase which is part of the SCF family of ubiquitin ligases. Ubiquitin ligases catalyse the transfer of ubiquitin from the ubiquitin conjugating enzyme (E2), to the substrate protein.
InterPro ACC:IPR014786
InterPro abstract:

This entry represents a domain found in the C-terminal of APC subunit 2 (ANAPC2).

ANAPC2 is part of the catalytic component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle [ PUBMED:11739784 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 082 APC2 domains in 1 081 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing APC2 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing APC2 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Replication

Relevant references for this domain

Primary literature for the APC2 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a APC2 domain which could be assigned to a KEGG orthologous group, and not all proteins containing APC2 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamAPC2
InterProIPR014786