The IRS domain within your query sequence starts at position 232 and ends at position 334, and its E-value is 2.16e-33.
YKDVWQVVVKPRGLGHRKELSGVFRLCLTDEEVVFVRLNTEVASVVVQLLSIRRCGHSEQYFFLEVGRSTVIGPGELWMQVDDSVVAQNMHELFLEKMRALCA
IRSPhosphotyrosine-binding domain | |
|---|---|
| SMART ACC: | SM001244 |
| Description: | - |
| Family alignment: | View the Family alignment or the Alignment consensus sequence |
| There are 6 799 IRS domains in 6 794 proteins in SMART's NRDB database. | |
Taxonomic distribution of proteins containing IRS domains
The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing IRS domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.
KEGG pathways involving proteins which contain this domain
This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a IRS domain which could be assigned to a KEGG orthologous group, and not all proteins containing IRS domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.
KEGG pathways
Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.
KEGG orthologous groups
Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.
3D structures in PDB containing this domain
Links to other resources describing this domain
| Pfam | IRS |
|---|