The SEC14 domain within your query sequence starts at position 150 and ends at position 301, and its E-value is 1.19e-16.

YKKVISHGGYYGDGLNAIVVFAVCFMPESGQPNYRYLMDNLFKYVIGTLELLVAENYMIIYLNGATTRRKMPSLGWLRRCYQQIDRRLRKNLKSLIIVHPSWFIRTLLAVTRPFISSKFSQKIRYVFNLAELAELVPMEYVGIPECIKQYVC
SEC14

SEC14

Domain in homologues of a S. cerevisiae phosphatidylinositol transfer protein (Sec14p)
SMART ACC:SM000516
Description:Domain in homologues of a S. cerevisiae phosphatidylinositol transfer protein (Sec14p) and in RhoGAPs, RhoGEFs and the RasGAP, neurofibromin (NF1). Lipid-binding domain. The SEC14 domain of Dbl is known to associate with G protein beta/gamma subunits.
InterPro ACC:IPR001251
InterPro abstract:

The CRAL-TRIO domain is a protein structural domain that binds small lipophilic molecules [ PUBMED:12767229 ]. The domain is named after cellular retinaldehyde-binding protein (CRALBP) and TRIO guanine exchange factor.

The CRAL-TRIO domain is found in GTPase-activating proteins (GAPs), guanine nucleotide exchange … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 22 196 SEC14 domains in 22 009 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing SEC14 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing SEC14 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the SEC14 domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the SEC14 domain.

ProteinDescriptionDisease / phenotype
TTPA_HUMANOMIM:600415 : Ataxia with isolated vitamin E deficiency
OMIM:277460 : no description
NF1_HUMANOMIM:162200 : Neurofibromatosis, type 1 ; Watson syndrome
OMIM:193520 : Leukemia, juvenile myelomonocytic ; Melanoma, desmoplastic neurotropic
RLBP1_HUMANOMIM:180090 : Retinitis pigmentosa, autosomal recessive

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a SEC14 domain which could be assigned to a KEGG orthologous group, and not all proteins containing SEC14 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001251