The ZnF_C2H2 domain within your query sequence starts at position 523 and ends at position 554, and its E-value is 1.93e2.

YNCQFCDFRYSKSHGPDVIVVGPLLRHYQQLH
ZnF_C2H2

ZnF_C2H2

zinc finger
SMART ACC:SM000355
Description: -
InterPro ACC:IPR013087
InterPro abstract:

This entry represents the classical C2H2 zinc finger domain.

C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short β-hairpin and an α-helix (β/β/α structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 594 488 ZnF_C2H2 domains in 441 262 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing ZnF_C2H2 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing ZnF_C2H2 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the ZnF_C2H2 domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the ZnF_C2H2 domain.

ProteinDescriptionDisease / phenotype
GLI3_HUMANOMIM:165240 : Greig cephalopolysyndactyly syndrome
OMIM:175700 : Pallister-Hall syndrome
OMIM:146510 : Polydactyly, preaxial, type IV
OMIM:174700 : Polydactyly, postaxial, types A1 and B
OMIM:174200 : no description
WT1_HUMANOMIM:194070 : Wilms tumor, type 1 ; Denys-Drash syndrome ; Frasier syndrome
OMIM:136680 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a ZnF_C2H2 domain which could be assigned to a KEGG orthologous group, and not all proteins containing ZnF_C2H2 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

Pfamzf-C2H2
PROSITEZINC_FINGER_C2H2
InterProIPR013087