The Zn_pept domain within your query sequence starts at position 119 and ends at position 400, and its E-value is 3.77e-127.

YNDWDKIVSWTEKMLEKHPEMVSRIKIGSTVEDNPLYVLKIGKKDGERKAIFMDCGIHAREWISPAFCQWFVYQATKSYGKNKIMTKLLDRMNFYVLPVFNVDGYIWSWTQDRMWRKNRSRNQNSTCIGTDLNRNFDVSWDSSPNTNKPCLNVYRGPAPESEKETKAVTNFIRSHLNSIKAYITFHSYSQMLLIPYGYTFKLPPNHQDLLKVARIATDALSTRYETRYIYGPIASTIYKTSGSSLDWVYDLGIKHTFAFELRDKGKSGFLLPESRIKPTCKE
Zn_pept

Zn_pept

SMART ACC:SM000631
Description: -
InterPro ACC:IPR000834
InterPro abstract:

This group of sequences contain a diverse range of gene families, which include metallopeptidases belonging to MEROPS peptidase family M14 (carboxypeptidase A, clan MC), subfamilies M14A and M14B.

The carboxypeptidase A family can be divided into four subfamilies: M14A (carboxypeptidase A or digestive), M14B (carboxypeptidase H or regulatory), M14C (gamma-D-glutamyl-L-diamino acid peptidase … expand

GO process:proteolysis (GO:0006508)
GO function:zinc ion binding (GO:0008270), metallocarboxypeptidase activity (GO:0004181)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 26 789 Zn_pept domains in 25 646 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Zn_pept domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Zn_pept domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Zn_pept domain which could be assigned to a KEGG orthologous group, and not all proteins containing Zn_pept domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000834
PfamZn_carbOpept