The PAH domain within your query sequence starts at position 29 and ends at position 64, and its E-value is 9.28e-18.

YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY
PAH

PAH

Pancreatic hormones / neuropeptide F / peptide YY family
SMART ACC:SM000309
Description:Pancreatic hormone is a regulator of pancreatic and gastrointestinal functions.
InterPro ACC:IPR001955
InterPro abstract:

This entry represents a group of animal proteins, including Pancreatic hormone [ PUBMED:6107857 ], also known as Pancreatic polypeptide is a peptide (PP), which is synthesized in pancreatic islets of Langherhans and acts as a regulator of pancreatic and gastrointestinal functions.

The hormone is produced as … expand

GO component:extracellular region (GO:0005576)
GO function:hormone activity (GO:0005179)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 772 PAH domains in 768 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PAH domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PAH domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the PAH domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PAH domain which could be assigned to a KEGG orthologous group, and not all proteins containing PAH domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITEPANCREATIC_HORMONE
InterProIPR001955
Pfamhormone3