The DUF862 domain within your query sequence starts at position 7 and ends at position 106, and its E-value is 5.05e-13.

YPVKLYVYDLSKGLARRLSPIMLGKQLEGIWHTSIVVHKDEFFFGSSGISSCTPGGTLLGPPDSVVDVGNTEVTEEIFLEYLSSLGESLFRSSQIGLLSS
DUF862

DUF862

PPPDE putative peptidase domain
SMART ACC:SM001179
Description:The PPPDE superfamily (after Permuted Papain fold Peptidases of DsRNA viruses and Eukaryotes), consists of predicted thiol peptidases with a circularly permuted papain-like fold. The inference of the likely DUB function of the PPPDE superfamily proteins is based on the fusions of the catalytic domain to Ub-binding PUG (PUB)/UBA domains and a novel alpha-helical Ub-associated domain (the PUL domain, after PLAP, Ufd3p and Lub1p) (PUBMED:15483401).
InterPro ACC:IPR008580
InterPro abstract:

The PPPDE superfamily (after Permuted Papain fold Peptidases of DsRNA viruses and Eukaryotes), consists of thiol peptidases with a circularly permuted papain-like fold. They contain a PPPDE domain which is a cysteine isopeptidase that exhibits a deSUMOylase activity in PPPDE2 (DeSI-1) and a deubiquinating activity in PPPDE1 (DeSI-2) and is described as a mixed α/β-fold composed of six β-strands … expand

GO function:peptidase activity (GO:0008233)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 4 571 DUF862 domains in 4 569 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DUF862 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DUF862 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the DUF862 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DUF862 domain which could be assigned to a KEGG orthologous group, and not all proteins containing DUF862 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR008580
PfamDUF862