The LY domain within your query sequence starts at position 349 and ends at position 391, and its E-value is 8.44e-4.

YSRLIPMLKNVVALDVEVATNRIYWCDLSYRKIYSAHMDKASI
LY

LY

Low-density lipoprotein-receptor YWTD domain
SMART ACC:SM000135
Description:Type "B" repeats in low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. Also present in a variety of molecules similar to gp300/megalin.
InterPro ACC:IPR000033
InterPro abstract:

The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells. The LDL receptor binds LDL and transports it into cells by acidic endocytosis. In order to be internalized, the receptor-ligand complex must first cluster into clathrin-coated pits. Once inside the cell, the LDLR separates from its … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 128 751 LY domains in 13 670 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing LY domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing LY domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the LY domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the LY domain.

ProteinDescriptionDisease / phenotype
LDLR_HUMANOMIM:143890 : Hypercholesterolemia, familial

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a LY domain which could be assigned to a KEGG orthologous group, and not all proteins containing LY domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

Pfamldl_recept_b
InterProIPR000033